PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA10G00482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 414aa    MW: 46919.4 Da    PI: 8.3205
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA10G00482genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-1799145148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +l+++v+q+G + W+ I++++  gR +kqc++rw+++l
       AA10G00482  99 KGQWTVEEDRKLIKLVRQHGERKWAMISEKLE-GRAGKQCRERWHNHL 145
                      799*****************************.*************97 PP

2Myb_DNA-binding54.72.3e-17152193245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + W++eE++ lv+a+++ G++ W+ Ia+ ++ gRt++++k++w+
       AA10G00482 152 DGWSEEEEKVLVEAHTRIGNK-WAEIAKLIP-GRTENSIKNHWN 193
                      56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.3994149IPR017930Myb domain
SuperFamilySSF466892.88E-2996192IPR009057Homeodomain-like
SMARTSM007177.3E-1698147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-26100152IPR009057Homeodomain-like
CDDcd001671.70E-14102145No hitNo description
PfamPF139212.0E-19102160No hitNo description
PROSITE profilePS5129417.952150200IPR017930Myb domain
SMARTSM007174.3E-14150198IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-20153198IPR009057Homeodomain-like
CDDcd001671.88E-10154196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MEDRRLHKTS FLHGAAPPLT AVERFLYGQK TQSLSPKNQE HPLHQPMVKS TPIEIRNDNK  60
ENMMFGQKKD KNLVSIGESK DYQKSKVITK KRPYKNLIKG QWTVEEDRKL IKLVRQHGER  120
KWAMISEKLE GRAGKQCRER WHNHLRPDIK KDGWSEEEEK VLVEAHTRIG NKWAEIAKLI  180
PGRTENSIKN HWNATKRRQN SKRKHKRHAN AENADTDASP SAKRPCILQD YIKSIDEHNK  240
ENITDENMIS SSNFDQINSD GDSASSFFGD PYDEELIFLE NIFANHQMSL ESIGLNQGSE  300
EINQSCSSLM MNNINPNPSP NPSLQSNVGT LRGSMVNTSH LASDLYLSYL LNGAATTSYS  360
SPSFASSASV EYNGYNELLG SQGNLNNERR EMDLIEMLSG SSSTQAQGSN ICFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-45971992104C-Myb DNA-Binding Domain
1msf_C4e-45971992104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195206KRRQNSKRKHKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401032.10.0hypothetical protein EUTSA_v10015404mg
TrEMBLV4KWZ10.0V4KWZ1_EUTSA; Uncharacterized protein
STRINGAT5G58850.10.0(Arabidopsis thaliana)
STRINGfgenesh2_kg.3__2684__AT5G58850.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.11e-169myb domain protein 119